PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A12G1309
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 249aa    MW: 28328.2 Da    PI: 6.5013
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A12G1309genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.61.4e-081348140
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqc 40
                     +g+WTteEd ll +++ ++G g W+  a++ g +   + +
      Gh_A12G1309 13 KGPWTTEEDTLLTHYIGRHGVGPWNMLAKCAG-T---NTL 48
                     79******************************.4...444 PP

2Myb_DNA-binding49.69e-1691134146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T +E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
      Gh_A12G1309  91 RGNLTLQEQQLILQLHSLWGNR-WSKIAEHLP-GRTDNEIKNYWRT 134
                      7899******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500909.361885IPR017877Myb-like domain
SuperFamilySSF466891.98E-2511132IPR009057Homeodomain-like
SMARTSM007171.4E-81287IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-201492IPR009057Homeodomain-like
CDDcd001671.01E-61585No hitNo description
PROSITE profilePS5129424.80486140IPR017930Myb domain
SMARTSM007172.7E-1490138IPR001005SANT/Myb domain
PfamPF002499.9E-1591134IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.8E-2393139IPR009057Homeodomain-like
CDDcd001672.15E-7111134No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MSTLIEEEIE VRKGPWTTEE DTLLTHYIGR HGVGPWNMLA KCAGTNTLIN KLFTLFFMFW  60
VDLPLTSSGL KRSGKSCRLR WLNYLNPDIK RGNLTLQEQQ LILQLHSLWG NRWSKIAEHL  120
PGRTDNEIKN YWRTRVQNKQ PSSSSLKEMS SQFSVPCQLP ECIVPSGSVI NISEQIEFPQ  180
HETSPNAYAH TCVDNNNLVL NGSYNIGRSG QDMEAFRLAS MSAVGEGCWI CNEMTDSLWQ  240
CRELGEMGN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-23131397107B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.209600.0boll
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012438235.10.0PREDICTED: myb-related protein 340-like isoform X1
TrEMBLA0A0D2U3Y60.0A0A0D2U3Y6_G
STRINGVIT_01s0011g03730.t011e-54(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2476734
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.17e-46myb domain protein 21